TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0A4G2|MTSA_STRPN Manganese ABC transporter substrate-binding lipoprotein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=psaA PE=1 SV=1
MKKLGTLLVLFLSAIILVACASGKKDTTSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTS
EADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSA
KDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLV
EKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTDSIAEQGKEGDSYYSMMKYNLDKIAEGLAK