TCDB is operated by the Saier Lab Bioinformatics Group
>P0A9S7|LIVG_ECOLI High-affinity branched-chain amino acid transport ATP-binding protein livG - Escherichia coli.
MSQPLLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILLRDQHLEGLPGQQIARM
GVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPSFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQR
RLEIARCMVTQPEILMLDEPAAGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQ
IRNNPDVIRAYLGEA