TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0CC32|NU2C1_ARATH NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Arabidopsis thaliana GN=ndhB1 PE=2 SV=1
MIWHVQNENFILDSTRIFMKAFHLLLFDGSFIFPECILIFGLILLLMIDLTSDQKDIPWLYFISSTSFVMSITALLFRWR
EEPMISFSGNFQTNNFNEIFQFLILLCSTLCIPLSVEYIECTEMAITEFLLFILTATLGGMFLCGANDLITIFVALECFS
LCSYLLSGYTKKDIRSNEATMKYLLMGGASSSILVYGFSWLYGSSGGEIELQEIVNGLINTQMYNSPGISIALIFITVGI
GFKLSLAPFHQWTPDVYEGSPTPVVAFLSVTSKVAALALATRIFDIPFYFSSNEWHLLLEILAILSMIFGNLIAITQTSM
KRMLAYSSIGQIGYVIIGIIVGDSNGGYASMITYMLFYIAMNLGTFACIILFGLRTGTDNIRDYAGLYTKDPFLALSLAL
CLLSLGGLPPLAGFFGKLYLFWCGWQAGLYFLVSIGLLTSVLSIYYYLKIIKLLMTGRNQEITPHMRNYRISPLRSNNSI
ELSMIVCVIASTILGISMNPIIAIAQDTLFSF