TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P10906|UGPE_ECOLI SN-glycerol-3-phosphate transport system permease protein ugpE - Escherichia coli.
MIENRPWLTIFSHTMLILGIAVILFPLYVAFVAATLDKQAVYAAPMTLIPGTHLLENIHNIWVNGVGTNSAPFWRMLLNS
FVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFITLMLPVEVRIFPTVEVIANLQMLDSYAGLTLPLMASATATF
LFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIAT
GEGTTEWNSVMVAMLLTLIPPVVIVLVMQRAFVRGLVDSEK