TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P23297|S10A1_HUMAN Protein S100-A1 OS=Homo sapiens GN=S100A1 PE=1 SV=2
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVA
ALTVACNNFFWENS