TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P23936|LACY_STRTR LACTOSE PERMEASE (LACTOSE-PROTON SYMPORT) (LACTOSE TRANSPORT PROTEIN) - Streptococcus thermophilus.
MEKSKGQMKSRLSYAAGAFGNDVFYATLSTYFIMFVTTHLFNTGDPKQNSHYVLLITNIISILRILEVFIDPLIGNMIDN
TNTKYGKFKPWVVGGGIISSITLLLLFTDLGGLNKTNPFLYLVLFGIIYLVMDVFYSIKDIGFWSMIPALSLDSHEREKM
ATFARIGSTIGANIVGVAIMPIVLFFSMTNNSGSGDKSGWFWFAFIVALIGVITSIAVGIGTREVESKIRDNNEKTSLKQ
VFKVLGQNDQLMWLSLGYWFYGLGINTLNALQLYYFTFILGDSGKYSILYGLNTVVGLVSVSLFPTLADKFNRKRLFYGC
IAVMLGGIGIFSIAGTSLPIILTAAELFFIPQPLVFLVVFMIISDSVEYGQWKTGHRDESLTLSVRPLIDKLGGAMSNWL
VSTFAVAAGMTTGASASTITTHQQFIFKLGMFAFPAATMLIGAFIVARKITLTEARHAKIVEELEHRFSVATSENEVKAN
VVSLVTPTTGYLVDLSSVNDEHFASGSMGKGFAIKPTDGAVFAPISGTIRQILPTRHAVGIESEDGVIVLIHVGIGTVKL
NGEGFISYVEQGDRVEVGQKLLEFWSPIIEKNGLDDTVLVTVTNSEKFSAFHLEQKVGEKVEALSEVITFKKGE