TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P25256|TLRC_STRFR Tylosin resistance ATP-binding protein tlrC - Streptomyces fradiae.
MRTSPSSQLSLHGVTKRYDDRVVLSQVSLAISPGEKAGIIGDNGAGKSTLLRLLAGEERPDAGEVTVIAPGGVGYLPQTL
GLPPRATVQDAIDLAMTELRVLEAELRRTEAALAEAATDEALQDALTAYARLTEQYEVRDGYGADARVDAALHGLGLPGL
PRDRRLGTLSGGERSRLALAATLASQPELLLLDEPTNDLDDRAVHWLEEHLSGHRGTVVTVTHDRVFLDRLTATVLEVDG
RGVSRHGDGYAGYLAAKAAERRRRQQQYDEWRAELDRNRRLAEANVARLDGIPRKMGKAAFGHGAFRARGRDHGAMSRVR
NAKERVERLTANPVAPPADRLSLTARIATADGPGEAPAAELDGVVVGSRLRVPKLRLGAAERLLITGPNGAGKSTLLSVL
AGELSPDAGAVSVPGRVGHLRQEETPWPAKLTVLEAFAHNRPGDRDEQADRRLSLGLFEPEALRLRVGELSYGQRRRIEL
ARLVSEPVGLLLLDEPTNHLSPALVEELEEALTGYGGALVLVTHDRRMRSRFTGSHLELREGVVSGAR