TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P26381|PTFC_BACSU PTS system, fructose-specific IIC component (EIIC-FRU) (Fructose- permease IIC component) (Phosphotransferase enzyme II, C component) (P28) - Bacillus subtilis.
MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALGWMNVGLAMAPDTAIASVIST
ILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIHRADQYAKAGNIKGIEIMHITAMVFQALRVMIPTLIVALIS
VSAVQAFLGNIPDVITKGLQIGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ
KQSAHGAVAAASDSGSVAVYDDDDDDLDA