TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P26382|PTFD_BACSU PTS system, fructose-specific IID component (EIID-FRU) (Fructose- permease IID component) (Phosphotransferase enzyme II, D component) (P30) - Bacillus subtilis.
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQRHLEWFNTHPWLTAPIFGVTA
AMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTIRPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLK
YGYVKGMEILQDLAGNRIQKLTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA