TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P29340|UBCX_YEAST Ubiquitin-conjugating enzyme E2-21 kDa OS=Saccharomyces cerevisiae GN=PEX4 PE=1 SV=1
MPNFWILENRRSYTSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI
LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRC
GDMSAYQGIVKYFLAERERINNH