TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P31826|YDDA_ECOLI Inner membrane ABC transporter ATP-binding protein YddA OS=Escherichia coli (strain K12) GN=yddA PE=1 SV=2
MITIPITLRMLIAKYLCLLKPFWLRKNNKTSVLLIIIILAMILGVVKIQVWLNDWNNDFFNALSQKETDKLWQLVLWFPA
LLGIFVLISVNKTWLIKLLTIRWREWLTDYYLNRWFADKNYYFTQIYGEHKNTDNPDQRIAEDILLLISKTLSLSFGFIQ
SLSMLITFTVILWESAGTLSFTVGGTEWNIQGYMVYTVVLIVIGGTLFTHKVGKRIRPLNVEKQRSEATFRTNLVQHNKQ
AELIALSNAESLQRQELSDNFHTIKENWHRLMNRQRWLDYWQNIYSRSLSVLPYFLLLPQFISGQINLGGLMKSRQAFML
VSNNLSWFIYKYDELAELAAVIDRLYEFHQLTEQRPTNKPKNCQHAVQVADASIRTPDNKIILENLNFHVSPGKWLLLKG
YSGAGKTTLLKTLSHCWPWFKGDISSPADSWYVSQTPLIKTGLLKEIICKALPLPVDDKSLSEVLHQVGLGKLAARIHDH
DRWGDILSSGEKQRIALARLILRRPKWIFLDETTSHLEEQEAIRLLRLVREKLPTSGVIMVTHQPGVWNLADDICDISAV
L