TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P34230|PXA2_YEAST Peroxisomal long-chain fatty acid import protein 1 (Peroxisomal ABC transporter 2) - Saccharomyces cerevisiae (Baker's yeast).
MISTASAFYQKHRVNLLRSSYIILLLATLYNSNSSSSNNKTDKKDSESTVLENKKIEEGKETAVDREEDESSKEELTIVS
KHSTDSEDGAIIIDKESKTNHKGGERKGKVDFLFKLLLHDKKCLILFITQAILLNIRTLLSLRVATLDGQLVSTLVRAQY
ANFTKILLGKWMILGIPASFINSLISYTTKLCAVTINRKVSDFLLSKYLSNHHTFYSVASAESVSEIQDNLTKDIYTFSM
NSSLLLNQLLKPMLDLILCSFKLLTSNTSVMGEGTLALGLIVYASNSLLKLIQPNFTRLTMASASLESWFRSLHSNLHSS
NEEIALLRGQKRELENVDYSFYRLVLFLNREIKARAIYDVATAFVIKYTWGAAGLVLCSIPIFFKNKPSEDTLQLKEPGN
DMTADFITNRRLLVTASSSIGRFVELKRNIQQLRGIRLRLNKFNDLLDANKGDDEKEPRDERCIVEYDDSRIKFENIPLI
TPANQVLVPELSFDLKHGNHLLIIGPNGCGKSSLFRILGGLWPIRATPNKNHQSKLIMPRRTVDRDCAIFYLPQRPYMGN
RSTFREQIIYPDSIEQFKERYHNDYDLGDADLIKILQLLDLEDLVTENMSLLLAQRTSKNDSQQLSTEDNQSPCAIKVRD
AFSIVRNWSEELTIGVQQRLAMARMYYHKPKFAVLDECTSAVAPEMEQRMYENAQNFGISLISVCHRTSLWHFHNYLLKF
DGKGGYQFGPFNPKERLCNEEKLLELNAILDQQVPLWERKLKDLTIAKESNIIRKSETNLNLFEKIEDPKTSKSNALFNA
NKGQRITSPTGQETSKRLPLFSQPSSSASSNLLRNNKSLNKKVKTKKEEGKER