TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 OS=Homo sapiens GN=CNR2 PE=1 SV=1
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGAD
FLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVL
SALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKC
VRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC