TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P37602|PHSC_SALTY Thiosulfate reductase cytochrome B subunit - Salmonella typhimurium.
MNTIWGAELHYAPDYWPLWLIYAGVVVLLMLVGLVIHALLRRMLAPKTAGGEEHRDYLYSLAIRRWHWGNALLFVLLLLS
GLFGHFSLGPVALMVQVHTWCGFALLAFWVGFVLINLTTGNGRHYRVNFSGLVTRCIRQTRFYLFGIMKGEAHPFVATEQ
NKFNPLQQLAYLAIMYALVPLLIITGLLCLYPQVAGLGPVMLVLHMALAIIGLLFICAHLYLCTLGDTPGQIFRSMVDGY
HRHRTAPRGDKSAV