TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P38855|PEX18_YEAST Peroxisomal membrane protein PEX18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX18 PE=1 SV=1
MNSNRCQTNEVNKFISSTEKGPFTGRDNTLSFNKIGSRLNSPPILKDKIELKFLQHSEDLNQSRSYVNIRPRTLEDQSYK
FEAPNLNDNETSWAKDFRYNFPKNVEPPIENQIANLNINNGLRTSQTDFPLGFYSQKNFNIASFPVVDHQIFKTTGLEHP
INSHIDSLINAEFSELEASSLEEDVHTEEENSGTSLEDEETAMKGLASDIIEFCDNNSANKDVKERLNSSKFMGLMGSIS
DGSIVLKKDNGTERNLQKHVGFCFQNSGNWAGLEFHDVEDRIA