TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P39196|YGED_ECOLI Hypothetical protein ygeD - Escherichia coli.
MSESVHTNTSLWSKGMKAVIVAQFLSAFGDNALLFATLALLKAQFYPEWSQPILQMVFVGAYILFAPFVGQVADSFAKGR
VMMFANGLKLLGAASICFGINPFLGYTLVGVGAAAYSPAKYGILGELTTGSKLVKANGLMEASTIAAILLGSVAGGVLAD
WHVLVALAACALAYGGAVVANIYIPKLAAARPGQSWNLINMTRSFLNACTSLWRNGETRFSLVGTSLFWGAGVTLRFLLV
LWVPVALGITDNATPTYLNAMVAIGIVVGAGAAAKLVTLETVSRCMPAGILIGVVVLIFSLQHELLPAYALLMLIGVMGG
FFVVPLNALLQERGKKSVGAGNAIAVQNLGENSAMLLMLGIYSLAVMIGIPVVPIGIGFGALFALAITALWIWQRRH