TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P39718|PEX22_YEAST Peroxisome assembly protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX22 PE=1 SV=1
MPPPSRSRINKTRTLGIVGTAIAVLVTSYYIYQKVTSAKEDNGARPPEGDSVKENKKARKSKCIIMSKSIQGLPIKWEEY
AADEVVLLVPTSHTDGSMKQAIGDAFRKTKNEHKIIYCDSMDGLWSCVRRLGKFQCILNSRDFTSSGGSDAAVVPEDIGR
FVKFVVDSDVEDVLIDTLCN