TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P39803|YITT_BACSU UPF0750 membrane protein yitT OS=Bacillus subtilis (strain 168) GN=yitT PE=3 SV=2
MVLDQTKKLLIVIIGALLNAAGLNLFLIPADVYASGFTGVAQLLSSVVDQYAPFYISTGTLLFLLNIPVGILGWLKVGKS
FTVYSILSVALTTLFMGILPETSLSHDILLNAVFGGVISAVGIGLTLKYGASTGGLDIVAMVLAKWKDKPVGTYFFILNG
IIILTAGLLQGWEKALYTLVTLYVTTRVIDAIHTRHMKLTAMIVTKKADEIKEAIYGKMVRGITTVPAKGAFTNEQKEMM
IIVITRYELYDLEKIVKEVDPKAFTNIVQTTGIFGFFRKD