TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P42199|YCKK_BACSU Probable amino-acid ABC transporter extracellular binding protein yckK precursor - Bacillus subtilis.
MKKALLALFMVVSIAALAACGAGNDNQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVA
KRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLT
SNYNKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGEPQSTYFTFRKGSGEVVDQ
VNKALKEMKEDGTLSKISKKWFGEDVSK