TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45756|GSPA_ECOLI Putative general secretion pathway protein A OS=Escherichia coli (strain K12) GN=gspA PE=1 SV=1
MSTRREVILSWLCEKRQTWRLCYLLGEAGSGKTWLAQQLQKDKHRRVITLSLVVSWQGKAAWIVTDDNAAEQGCRDSAWT
RDEMAGQLLHALHRTDSRCPLIIIENAHLNHRRILDDLQRAISLIPDGQFLLIGRPDRKVERDFKKQGIELVSIGRLTEH
ELKASILEGQNIDQPDLLLTARVLKRIALLCRGDRRKLALAGETIRLLQQAEQTSVFTAKQWRMIYRILGDNRPRKMQLA
VVMSGTIIALTCGWLLLSSFTATLPVPAWLIPVTPVVKQDMTKDIAHVVMRDSEALSVLYGVWGYEVPADSAWCDQAVRA
GLACKSGNASLQTLVDQNLPWIASLKVGDKKLPVVVVRVGEASVDVLVGQQTWTLTHKWFESVWTGDYLLLWKMSPEGES
TITRDSSEEEILWLETMLNRALHISTEPSAEWRPLLVEKIKQFQKSHHLKTDGVVGFSTLVHLWQVAGESAYLYRDEANI
SPETTVKGK