TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45767|YHDX_ECOLI Putative amino-acid ABC transporter permease protein YhdX OS=Escherichia coli (strain K12) GN=yhdX PE=3 SV=3
MSHRRSTVKGSLSFANPTVRAWLFQILAVVAVVGIVGWLFHNTVTNLNNRGITSGFAFLDRGAGFGIVQHLIDYQQGDTY
GRVFIVGLLNTLLVSALCIVFASVLGFFIGLARLSDNWLLRKLSTIYIEIFRNIPPLLQIFFWYFAVLRNLPGPRQAVSA
FDLAFLSNRGLYIPSPQLGDGFIAFILAVVMAIVLSVGLFRFNKTYQIKTGQLRRTWPIAAVLIIGLPLLAQWLFGAALH
WDVPALRGFNFRGGMVLIPELAALTLALSVYTSAFIAEIIRAGIQAVPYGQHEAARSLGLPNPVTLRQVIIPQALRVIIP
PLTSQYLNIVKNSSLAAAIGYPDMVSLFAGTVLNQTGQAIETIAMTMSVYLIISLTISLLMNIYNRRIAIVER