TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P46318|PTCB_BACSU PTS SYSTEM, CELLOBIOSE-SPECIFIC IIB COMPONENT (EIIB-CEL) (CELLOBIOSE- PERMEASE IIB COMPONENT) (PHOSPHOTRANSFERASE ENZYME II, B COMPONENT) (EC 2.7.1.69) - Bacillus subtilis.
MNILLVCAAGMSTSLLVSKMEKSAQEQGKDYTIWAVSGDSVQNHIDKADVLLLGPQVRYMLPQLKKLGESKGVPVDVINT
VHYGTCNGAEVLKSAEQLGHVS