TCDB is operated by the Saier Lab Bioinformatics Group
>P49022|PIP_LACLA Phage infection protein - Lactococcus lactis subsp. lactis (Streptococcus lactis).
MKSIKNTWKLFALDWKRIFKNPVATFLIVALMIIPSLYAWFNIKALWDPYANTSQLPIAVYSADKPASFQDKTINIGDEV
LKNLKKNHQLGWKFVDSKAELDKGVKSGKYYAGIYLPKDFSKDLLSFTTGDIKKPQIVYSINEKINAIAPKITSKGASSL
QSQISEEFINTASSTLLKTFNTIGYDIDKNMVSIQKVKSAILSTNDNLGTIDKYTQQVVDLHGKMPEIKEKLAKANEFIT
YLPEVDSLGQKVISLNDKMPEIDKSLSLVLTLQEKIPEIQNAGKQISMIDEDFASVESTMTQGIQEAKDGLQIINQVQKS
MPDIQKLGQDADSLGTVTLDAAKKMQSALPSITNSVQITLQSIQEFSKNTSSVLAVIDQAIADNQLTDEEKEQINSLITN
FINNIARQREAIQNIVDYMKQVQESNGSHDLDSTIEQLSNLDSLLSGLSTRMNHLNELVQNGDVSEIRAYLSQINDVVTK
ISNLVDNIDVSGISKTIDTVLTSLTKTIADAKGLLNQAQQIDFEALLNSTSQTVSNAVTILEKYQGEMPAIKQEIHDANL
MLNGNMTTIVNAINEGASLYKNEFPILKTKLGTASDFFKNDYAGVRKDLTDTLTMANEKMPDVESALNQANSLIQNDWPE
IKSGIQKAATAIQKGEKEVDLGEIVKLLKLDATKESDFWTQPVEVQENQVYPIANNGSASTPFYTALCLWVGAVLLSSLA
TTEVHLSDKDKKRYSKREQFFARMGSFVAIGLAQALIVTLGNYFGLGVDVRDPFYSVLFALLISIAFMIMVYVLVALFGN
VGKGIAIIILVLSISGGGGNYPIQVSGKFFQAINPYLPFTHAVNLLRESAGGIYWPNAWFAIIILVAVSIIFVAIGAILF
PHFEDKTKKISEIGSKSHFFH