TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P53099|YGT6_YEAST Tpn1 64.5 kDa protein in COX4-GTS1 intergenic region - Saccharomyces cerevisiae (Baker's yeast).
MNRDNMDTTKRKEDHTKHTTDVIEFYEEGTAASSLNIATEKANSSPSILRRIINRAAWLSKKVDAMGVESTGIQRISPYE
RGTSKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFGLSFRESVASSLISVTIGCLIAAYCSIMGPQSGCRQMVTARYLFG
WWFVKLVALASIIGVMGWSVVNSVVGGEMLAAISNDKVPLWVGIVIVTVCSFLVAIFGIKQVIKVETYLSVPVLTAFLLL
YISSSDKYSFVNAYVSKGNLDSSTRKGNWMSFFSLCYSITATWGSITADYYILFPEDTPYIQIFCLTFFGTFLPTCFVGI
LGLLLASVAMSYKPWSVEYDSHGMGGLLWAGFQRWNGFGKFCVVVLVFSLVSNNIINTYSAAFSIQLSSVFCAKIPRWFW
SIVCTIICLVCALIGRNHFSTILGNFLPMIGYWISMYFILLFEENLVFRRFFLHLYTKEFPTVTGEINGPELVGSSKEVE
KDAVTNIHLLKRKHKVTKHRYNWDKWEDYEVLTHGYAATFAFIVGVAGVVVGMAQAYWIGPIAAKFGEYGGDVAMWLSMA
FSGVVYPPCRYLELRKFGR