TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P55339|ECSA_BACSU ABC-type transporter ATP-binding protein EcsA OS=Bacillus subtilis (strain 168) GN=ecsA PE=1 SV=1
MSLLSVKDLTGGYTRNPVLKNVSFTLEPNQIVGLIGLNGAGKSTTIRHIIGLMDPHKGSIELNGKTFAEDPEGYRSQFTY
IPETPVLYEELTLMEHLELTAMAYGLSKETMEKRLPPLLKEFRMEKRLKWFPAHFSKGMKQKVMIMCAFLAEPALYIIDE
PFLGLDPLAINALLERMNEAKKGGASVLMSTHILATAERYCDSFIILHNGEVRARGTLSELREQFGMKDAALDDLYLELT
KEDAGHE