TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P56752|NU5C_ARATH NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Arabidopsis thaliana GN=ndhF PE=3 SV=1
MEHTYQYSWIIPFIPLPVPILLGVGLLLFPTATKNLRRMWTFLSIFLLSIVMIFSIYLSIQQIFLSCIHQNVWSWTINNE
FSFEFGYFIDPLTSIMSILITTVGILVLIYSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYL
LIGFWFTRPIAANACQKAFVTNRVGDFGLLLGILGLYWITGSFEFQDLFEIFNNLILNNRVNLLFLTLCAFLLFVGPIAK
SAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPSIMYIISLIGIITVLLGATLALAQKDIKRGLA
YSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLI
GTLSLCGIPPLACFWSKDEILNDSLLFSPIFAIIACSTAGLTAFYMFRIYLLTFEGHLNTYFLNYSGKKSGSFYSLSLWG
KEEEKKLNKNFGLVPLLTMNNTKRASFFCNKTYKISNNVRNQIFITVENFGLNTRTFYYPHESDNTILFPMLILVLFTLF
IGAIGIPFNQEGIDFDILSKFFTPSINLLHKNSQNFVDWYEFLRNATFSVSIAFFGIFIAYCLYKPFYSSLLNLTLLNSF
QKWNSKRIHWEKLINFVYNWSYNRGYIDSFFKTSLIESIRRLAKQTTFFDKRIIDGITNGVGITSFFVGEVTKYIGGSRI
SSYLFLYLSYVLIFLMILFFFYFEKF