TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P56754|NDHJ_ARATH NAD(P)H-quinone oxidoreductase subunit J, chloroplastic OS=Arabidopsis thaliana GN=ndhJ PE=3 SV=1
MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQ
AEEVCIKVFTHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY