TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P56756|NDHK_ARATH NAD(P)H-quinone oxidoreductase subunit K, chloroplastic OS=Arabidopsis thaliana GN=ndhK PE=3 SV=1
MNSIKFPILDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRSSPRQADLILTAGT
VTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKIARE
IYKDRIRPQQGNRCFTTNHKFFVVRSPHIGNYDQELLYPPSSTSEISTETFFKYKSPVSSHELVN