TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P62837|UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens GN=UBE2D2 PE=1 SV=1
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS
NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM