TCDB is operated by the Saier Lab Bioinformatics Group
>P70423|CTR3_MOUSE Cationic amino acid transporter 3 - Mus musculus (Mouse).
MLWQALRRFGQKLVRRRVLELGMGETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLA
GLCYAEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISRTLKGTILLKMPHVL
AEYPDFFALALVLLLTGLLVLGASKSALVTKVFTGMNLLVLSFVIISGFIKGELRNWKLTKEDYCLTMSESNGTCSLDSM
GSGGFMPFGLEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISMFICFLAYFGVSSALTLMMPYYKLHPESP
LPEAFSYVGWEPARYLVAIGSLCALSTSLLGSMFPMPRVMYSMAEDGLLFRVLAKVHSVTHIPIVATLVSGVIAAFMAFL
FELTDLVDLMSIGTLLAHSLVSICVLILRYQPDQEMKSVEEEMELQEETLEAEKLTVQALFCPVNSIPTLLSGRVVYVCS
SLLAVLLTVLCLVLTWWTTPLRSGDPVWVTVVVLILGLILAISGVIWRQPQNRTPLHFKVPAVPLLPLVSIFVNVYLMMQ
MTAGTWARFGIWMLIGFAIYFGYGIQHSMKEVKNHQTLPKTRAQTIDLDLTTSCVHSI