TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P75905|YCDQ_ECOLI HYPOTHETICAL 50.8 KDA PROTEIN IN PHOH-CSGG INTERGENIC REGION - Escherichia coli.
MINRIVSFFILCLVLCIPLCVAYFHSGELMMRFVFFWPFFMSIMWIVGGVYFWVYRERHWPWGENAPAPQLKDNPSISII
IPCFNEEKNVEETIHAALAQRYENIEVIAVNDGSTDKTRAILDRMAAQIPHLRVIHLAQNQGKAIALKTGAAAAKSEYLV
CIDGDALLDRDAAAYIVEPMLYNPRVGAVTGNPRIRTRSTLVGKIQVGEYSSIIGLIKRTQRIYGNVFTVSGVIAAFRRS
ALAEVGYWSDDMITEDIDISWKLQLNQWTIFYEPRALCWILMPETLKGLWKQRLRWAQGGAEVFLKNMTRLWRKENFRMW
PLFFEYCLTTIWAFTCLVGFIIYAVQLAGVPLNIELTHIAATHTAGILLCTLCLLQFIVSLMIENRYEHNLTSSLFWIIW
FPVIFWMLSLATTLVSFTRVMLMPKKQRARWVSPDRGILRG