TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P77308|DDPB_ECOLI Probable D,D-dipeptide transport system permease protein DdpB OS=Escherichia coli (strain K12) GN=ddpB PE=1 SV=1
MTFWSILRQRCWGLVLVVAGVCVITFIISHLIPGDPARLLAGDRASDAIVENIRQQLGLDQPLYVQFYRYVSDLFHGDLG
TSIRTGRPVLEELRIFFPATLELAFGALLLALLIGIPLGILSAVWRNRWLDHLVRIMAITGISTPAFWLGLGVIVLFYGH
LQILPGGGRLDDWLDPPTHVTGFYLLDALLEGNGEVFFNALQHLILPALTLAFVHLGIVARQIRSAMLEQLSEDYIRTAR
ASGLPGWYIVLCYALPNALIPSITVLGLALGDLLYGAVLTETVFAWPGMGAWVVTSIQALDFPAVMGFAVVVSFAYVLVN
LVVDLLYLWIDPRIGRGGGE