TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P77315|YPHD_ECOLI Probable ABC transporter permease protein YphD OS=Escherichia coli (strain K12) GN=yphD PE=3 SV=1
MSASSLPLPQGKSVSLKQFVSRHINEIGLLVVIAILYLVFSLNAPGFISLNNQMNVLRDAATIGIAAWAMTLIIISGEID
VSVGPMVAFVSVCLAFLLQFEVPLAVACLLVLLLGALMGTLAGVLRGVFNVPSFVATLGLWSALRGMGLFMTNALPVPID
ENEVLDWLGGQFLGVPVSALIMIVLFALFVFISRKTAFGRSVFAVGGNATAAQLCGINVRRVRILIFTLSGLLAAVTGIL
LAARLGSGNAGAANGLEFDVIAAVVVGGTALSGGRGSLFGTLLGVLVITLIGNGLVLLGINSFFQQVVRGVIIVVAVLAN
ILLTQRSSKAKR