TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P83962|ANFV_ACITR Ventricular natriuretic peptide OS=Acipenser transmontanus GN=vnp PE=2 SV=1
MRMGKIAVGYGFLLLLVFQLGVRASTLFNKYNVQELSSLKDLLERLEEKLSPGEESDVYAGSEDLVNDPEEDADLILDNV
RKQAEKEFYKPAGFRDENLQRGRLRSIATSARSMNGCFGNRIERIGSWSSLGCNNSRFGSKKRIF