TCDB is operated by the Saier Lab Bioinformatics Group
>P90670|P90670_APLCA Sodium channel alpha-subunit SCAP1 - Aplysia californica (California sea hare).
MDHELAEWTPFRLFTRESLFTIDRRIAEEEAAKHAEKAPPESDDDDEELDEPSHHEENLKPNPKLEAGRKLPPSLEDYPR
EYVGKPLEDLDEFYHNQKTFVVLKKDKAIFRFSATDAIFLLSPFNPIRRIAIYILVHPIFSLLVMMTILVNCVFMAITSY
TPPAFVEHIFLGIYTVEAVVKVLSRGFVLKPFTYLRDPWNWLDFFVISIAYMTMTVKSFGNLQALRTFRVLRALKTISVI
PGLKTIVGALLEAVRRLRDVMILTVFVLSIFALIGMQLYSGALRQKCVLNPVPELGTNITHDEWNDWVNNESHWQKDFYD
EWQVCGNGTGAGKCGNGTINGTAEWLCLPNIGQNPNHDFTSFDNFGMALLCAFRLMTQDFWESLYHLVLRAVGSAHCLYF
VLVILLGSFYLVNLILAIVAMSYDETQKQDQADAEEEAAERQEEEARKEALSIMTKSPSNSSWNNDFEAGVRTAGDKAEE
KERLSLTSDHSATSAHLKPSRLNQKRHSLSLPGSPYIHRRNSRGSQYSWRKPVPTAKRSPYCPDRQPLVHHTLENLPLPF
ADDSAAVTPSSEDLCNFSFIRNMPNGRRFSFASQRRPDGTGRSGSRRSSFASNHSRASRTSRGSGQGDRTKTQTLLNFKK
GKVPDVVLDKSKLDDDQDSVSSGGSGHCPEKDKASESNPFLSHSPGGPNVEMKDVMVLKDILDQASGHRRSFVSMTSIHQ
RTMKDIMWKYFCTWDCHPNFQKLQRLVSLFIMDAFVDLFITICILVNTAFMAMEHYDMEDDLKAVSNAANLVFTAIFAVE
AFLKILALSPVIYFKDGWNIFDSIIVALSLMELSMTKLPGLSVLRAFRLLRVFKLAKSWPTLNMLIAIVGRTMGALGNLI
IVLGIIIFIFAVMGQQLFSSDYKTYEREIDAWGNVTINKDKMPRWNFNDFLHSFMIVFRVLCGEWIESMWGCYLVSGWAC
VPFFLLTYVVGNLVVLNLFLALLLSSFGSESLQRSESDDEPSKIAEAIDRFKRFGNWVKVKIIVCIKVKLQRQKNWRPPP
TTGQSEVNGKDPAVVDGTVVSMEKTPDDFPDGPCCPAQAAICSAKKDLKSPSGSHSNSGSSHCSSCSSLSESAQTKKIDL
EADHEINEVEIVYVKEPDDCFCYMCTKRCPWCVKVEKSKIGRAWWAVRCFFYRLTENKYFDSFIIAMILASSCALALEDA
YLHEKPILKEILEYLDKVFTAIFIIEMLIKWLAFGFKTYFTDAWCWLDFTIVMLSIVMLVADLTASEEGGGSMSWMKSMR
TLRALRPLRAVSRWEGMRVVVNALFKAIPSICNVLLVCLVFWLIFGIMGVQLFNGKFHACRDEKGDKYPREEVPNKTVCI
DKGYNWTNAQINFDHVLSAYLALFQVATYKGWIDIMNNAIDSTEIGQQPSREENVIMYLFFVLFIVFCSFFTLNLFIGVI
IENFNSQKKKAGGSLEMFMTEDQKKYYNAMKRMQSKSPQKSIPRPKYKLAGLIFDITTDQKFDIAIMVIIILNMLTMMFE
HHGMSAQMKNILGIFNLIFITIFTAECVLKLIGLRWYYFKIPWNVFDFVVVVLSILASSLSEFEDSFFISPTLLRVIRVF
RVGRVLRLVKSAKGIRTLLFSMAVSLPALFNIGLLLGLIMFIYAIMGMNFFMGAEQKYGLDDAFNFDTFLRSFILLFQMC
TSAGWSDVLNGLIARCAPEGTCKDYNVATIYLATYLVVSFLVVVNMYIAVILENFSQATEDEQQGLTPDDFDMYYEKWEK
YDPKASKYIPLDQLSDFVDYLEEPLRLPKPNHFILVKLDIPICENDRCYCRDILDALTKNFLGTGETSDIPQKETDKEKE
EYKPISSTLRRQKEHYAARIIQKAYRNFKGITFGDGTGSSGKDEDTRSSKSDDDNDDDNGGDGRGGGMNGTRGGRRHGAE
NGEKTKDRDGSKRDGKDSPSKDSNDDSSQQAQDKPKETEDEEQRLQDSGIVIVNETDADPKTVELGPDSGVVA