TCDB is operated by the Saier Lab Bioinformatics Group
>tr|P92934 Amino acid permease 6 - Arabidopsis thaliana (Mouse-ear cress).
MEKKKSMFVEQSFPEHEIGDTNKNFDEDGRDKRTGTWMTGSAHIITAVIGSGVLSLAWAIAQLGWVAGPAVLMAFSFITY
FTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGLAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVK
CATSNTPFMIIFAIIQIILSQIPNFHNLSWLSILAAVMSFCYASIGVGLSIAKAAGGGEHVRTTLTGVTVGIDVSGAEKI
WRTFQAIGDIAFAYAYSTVLIEIQDTLKAGPPSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNDAPGNFLTGFGFYE
PFWLIDFANVCIAVHLIGAYQVFCQPIFQFVESQSAKRWPDNKFITGEYKIHVPCCGDFSINFLRLVWRTSYVVVTAVVA
MIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKIPKFSFTWTWLKILSWTCFIVSLVAAAGSVQGLIQSLKDFKPFQA
P