TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P94530|ARAQ_BACSU L-arabinose transport system permease protein AraQ OS=Bacillus subtilis GN=araQ PE=2 SV=2
MLRHSPQFSVYRIALTLFFMMLSLLYLFPIFCLLLGSLKPSSELLRVGLNLDIDPKVMSFDNYTFLFNGGSIYFKWFFNS
LVLGLFTTVLTLFFSSMIGYGLAVYDFKGRNIIFVLVLIIMMVPLEVMMLPLFKLTVGLHLIDSYTGVILPFIVSPVAVF
FFRQYALGLPRDLLDSARMDGCTEFGIFFRIMAPLMKPAFGAMIILQSLNSWNNFLWPLIVLRSKEMFTLPIGLSSLLSP
YGNNYDMLISGSVFAILPVIIIFLFFQKYFISGLTVGGVKG