TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P94575|YWOE_BACSU Hypothetical 54.0 kDa protein IN NRGA-USD intergenic region - Bacillus subtilis.
MKLKESQQQSNRLSNEDLVPLGQEKRTWKAMNFASIWMGCIHNIPTYATVGGLIAIGLSPWQVLAIIITASLILFGALAL
NGHAGTKYGLPFPVIIRASYGIYGANIPALLRAFTAIMWLGIQTFAGSTALNILLLNMWPGWGEIGGEWNILGIHLSGLL
SFVFFWAIHLLVLHHGMESIKRFEVWAGPLVYLVFGGMVWWAVDIAGGLGPIYSQPGKFHTFSETFWPFAAGVTGIIGIW
ATLILNIPDFTRFAETQKEQIKGQFYGLPGTFALFAFASITVTSGSQVAFGEPIWDVVDILARFDNPYVIVLSVITLCIA
TISVNVAANIVSPAYDIANALPKYINFKRGSFITALLALFTVPWKLMESATSVYAFLGLIGGMLGPVAGVMMADYFIIRK
RELSVDDLYSETGRYVYWKGYNYRAFAATMLGALISLIGMYVPVLKSLYDISWFVGVLISFLFYIVLMRVHPPASLAIET
VEHAQVRQAE