TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P9WQK3|ETTA_MYCTU Energy-dependent translational throttle protein EttA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ettA PE=1 SV=1
MAEFIYTMKKVRKAHGDKVILDDVTLSFYPGAKIGVVGPNGAGKSSVLRIMAGLDKPNNGDAFLATGATVGILQQEPPLN
EDKTVRGNVEEGMGDIKIKLDRFNEVAELMATDYTDELMEEMGRLQEELDHADAWDLDAQLEQAMDALRCPPADEPVTNL
SGGERRRVALCKLLLSKPDLLLLDEPTNHLDAESVQWLEQHLASYPGAILAVTHDRYFLDNVAEWILELDRGRAYPYEGN
YSTYLEKKAERLAVQGRKDAKLQKRLTEELAWVRSGAKARQAKSKARLQRYEEMAAEAEKTRKLDFEEIQIPVGPRLGNV
VVEVDHLDKGYDGRALIKDLSFSLPRNGIVGVIGPNGVGKTTLFKTIVGLETPDSGSVKVGETVKLSYVDQARAGIDPRK
TVWEVVSDGLDYIQVGQTEVPSRAYVSAFGFKGPDQQKPAGVLSGGERNRLNLALTLKQGGNLILLDEPTNDLDVETLGS
LENALLNFPGCAVVISHDRWFLDRTCTHILAWEGDDDNEAKWFWFEGNFGAYEENKVERLGVDAARPHRVTHRKLTRG