TCDB is operated by the Saier Lab Bioinformatics Group
>PRP76045.1 hypothetical protein PROFUN_01761 [Planoprotostelium fungivorum]
MEEEDGLRPQEIPSSPLIVKTTAQVETHTTIDFNEDQYYGNTRVAKSDPHADDPDTLVYMKNVHKTYLLGIEGVPALRGV
DLVIKRGEFVVIFGTSGGGKTTMLNILGTIDKPTKGELRLAGTRTFFLIRPPLMVTGVTSNTKDSELSNIRLQKIGFVFQ
TFNLLASLSAVENVEMPMILNGVLSTEDRRNRARELLAKVGMEPRMNHVPSQLSGGEQQRVTIARAIANSPEILLLDEPT
GDLDTVNTHLVMKLLADLNREEKITMIMVTHDVALKQFADRVIWMRDGKIQRIEMCDPKKKSDAIAKNEAELQEARRKRE
ESQKRQGPPVTEFRKPTDYNTHPGYGAVRPSQVKREVKEELVSLSPPQRTRENFPV