TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q00752|MSMK_STRMU Multiple sugar-binding transport ATP-binding protein MSMK - Streptococcus mutans.
MVELNLNHIYKKYPNSSHYSVEDFDLDIKNKEFIVFVGPSGCGKSTTLRMVAGLEDITKGELKIDGEVVNDKAPKDRDIA
MVFQNYALYPHMSVYDNMAFGLKLRHYSKEAIDKRVKEAAQILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMD
EPLSNLDAKLRVSMRAEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSSTKNEDGSGTIGRVEQVGTPQELYNRPANK
FVAGFIGSPAMNFFDVTIKDGHLVSKDGLTIAVTEGQLKMLESKGFKNKNLIFGIRPEDISSSLLVQETYPDATVDAEVV
VSELLGSETMLYLKLGQTEFAARVDARDFHEPGEKVSLTFNVAKGHFFDAETEAAIR