TCDB is operated by the Saier Lab Bioinformatics Group
>Q02006|Y4233_RHOPA Putative potassium channel protein RPA4233 - Rhodopseudomonas palustris.
MRDETPAYLRARHYFYEILESQAQTSRMGVIVNRFIVFFIVLSVGITVMESVPAMREDYGRLFQALELLCLVMFSIEYYI
RIWIAPEHLPYHHMSPLRAAWAYMISPQGIVDCISVMPLWIALFGPDDLRVLIILRMLRLLKFARYSSGMRSLLEVLESE
RRALMACLVILACATLVSATAMHIAEGHVQPEKFGTIPDAMWWAIVTLSTIGYGDVVPATGIGRMVASATIICGLIMIAL
PVGIVANAFSEVIHRRDFIVNWSMVARVPLFSHLTAGDIAHIMQLLQARQIERGEVVFRRGEPATAMYFIAEGDVEIELG
PEDKGRRIRLGTGHFFGEIAVLKRVERSATVKAVSRTRLLVLDGADLRALIAREPSIARKINQIVEGRTGRNLNLEIADL
EGQADVSVEENA