TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein aprD - Pseudomonas aeruginosa.
MARLGSSVTNEIKQALAASRGALRSVAAFSGVINLLMLVPSLYMLQVYDRVLSSANEVTLLMLTLMALGVFVFMGALEAL
RSFVLVRVSERFDGQLHGRIYAAAFERNLRAGGQEASQALHDLTTLRQFITGQALFAFFDAPWFPVYLLVIFLFDPWLGL
LSLVGALALMALAWFNERATRAPLAKAGELSIKSGQLASNNLRNAEVIEAMGMLGSMRGRWERLHQAFLDQQSLASERAA
RINALSKYLRIALQSLVLGLGAWLAVEGRITPGMMIAGSILMGRALGPIDQLIGVWKQWGAARDAYRRLSGLLDEFPARE
RRMELPEPRGHLLLESLDAAPPGSEARTLRGLTLAIPAGSVVGVIGPSGSGKSSLARVVLGIWPTLHGSVRLDGAEIRQY
ERETLGPRIGYLPQDIELFAGTVAENIARFGEVQADKVVEAARLAGVHELVLRLPQGYDTVLGVGGAGLSGGQRQRIALA
RALYGAPTLVVLDEPNSNLDDSGEQALLAAIQALKARGCTVLLITHRAGVLGCADRLLALNAGQLHLYGERDQVLAALNN
QRAASASQQRADYRVAGYGAPQVVAAPRQGGVE