TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q03370|PEX29_YEAST Peroxisomal membrane protein PEX29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX29 PE=1 SV=1
MDSVTNFFWNDTYNAGTPTRSTLKGKKVQNGIDGKSQAKKESISSGSRTSDPTRGSLPSSSGQPTSGGGFPSTSNIQKMM
ADTLVEKIIKMALPPSSKTAVDTIHHRMVAGKERPKLSVQITSRNFIQMNSRLGVPFMIMDELIKILNWTNPAYTVSIMF
LYTLIILKPFQMLSSLPIFYLLFCVMVPQYLYIHKPNPTSYLDNNQTPAQGPPLRRPEVPKPVPELSQEFVLNLTDLQNH
MLLYVKFYDFTLLILQKFAFFTNEAISSFYFIVLLIIATLNFLYMDKFIKLIPMRPVLILLGWGFFIASHPSNREYLLTK
LNSEETRLKTLTISTNLESKILQHLKLIEAREHRLVMIFEIQKYLPEYKEWRPVGFSDDDYSLFSSLRIYQRRIEENSVK
SLEEIEPPKDWEWEANSHWVLDLDPKEWVEDEFIQYVEIDSETKWVYDLNLDGQRGSYRRRMWTNSCVRKKLDSGISSNL
GEEEVVNPLREETYRQGVHGVTKGSMSGGLTHSSDDDRADEESINGTIPNLNNIDADASYPSIEELTDTLNSTI