TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q07757|NODJ_AZOC5 Nodulation protein J OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) OX=438753 GN=nodJ PE=3 SV=1
MRERMVTWAAVFQRNAMSWRREMAASVLGSVIDPLIMLFGLGVGLGKIVDSVDGRSYAEFLACGLILTSAMSASNYEMLY
GTYSRIYVTGTLKSMRYAPICVSDYLIGEVLWAAYEGVVAGTIVAVCTAFLGYIPGWSVIYILPDILFVALIFSSTSLLV
AAISRGYALFAFYQSIAIAPLVFLSGVIVPRFTGNDVISGMIHFSPLYRAVNDVRNVVYEGRGTQVGPLLLLSLLYASVM
VFISAKVICVRLDD