TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q08120|BACA_RHIME BACTEROID DEVELOPMENT PROTEIN BACA - Rhizobium meliloti (Sinorhizobium meliloti).
MFQSFFPKPKLFFISSAVWSLLAVLAWYAGGRDIGAYLGLPPLPPGQEPVIGVSVFWSTPFLWFYIYYAVVAGLFAAFWF
AYSPHRWQYWSVLGTALIIFNTYFSVQVSVAINAWYGPFYDLIQQALARTAPVTAGQLYSGMIGFSGIAFVAVTVGVLNL
FFVSHYIFRWRTAMNEFYVAHWPRLRHVEGASQRVQEDTMRFSSTVERLGVGLVSSIMTLIAFLPVLFKFSEQVNVLPIV
GEIPHALVWAAVFWSVFGTVFLAAVGIKLPGLEFRNQRVEAAYRKELVYGEDHEDRADPITLAQLFDNVRRNYFRLYFHY
MYFNIARIFYLQADNLFGTFVLVPAIVAGKLTLGVMNQVLNVFGQVRESFQYLVNSWTTIVELLSIYKRLKAFESVLVDE
PLPEIDRQFIDAGGKEELAL