TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0AG33|Q0AG33_NITEC Putative uncharacterized protein OS=Nitrosomonas eutropha (strain C91) GN=Neut_1453 PE=4 SV=1
MSMHHDKDPTTWSIEVWTLAIVMAIVGGLASIIQKLPCERTRPFSALELIGEMITSAFVGMLVFMALEAVDMPLGVCAAG
SGVGGHMATRLLFLVENVIEKRIKDMEREK