TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0P845|Q0P845_CAMJE Putative peptide ABC-transport system permease protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) GN=Cj1583c PE=3 SV=1
MLKRLVFSIFIAFFSTFLCFVLLHFSKGSIAYANGVNSQSKEFVQRIEQNLGLDKPLLEQYKIWLFKALKGDLGVSFLSG
ESVLKLIKERIFNTFILGFSALMLLFLLSVFLALLGYYYKESFIDKIITFLAFNFFALPPFVLALLFVLIFGIFWKILPV
MGSSDIGFEDDFLNRLEHLILPVLVLVLSHLALFLRIARNFINESFSQIFIQNLYARALREKDIYFLVLKYSLSPIVAYF
GGSALSFMMGTYVVESVFAYKGLGSLLFKSIIFKDYPIVLALIFFSVLLAAFFTFLSDIVARILNPRLRRLDFV