TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0P986|Q0P986_CAMJE 50 kDa outer membrane protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) GN=omp50 PE=4 SV=1
MKTRFSLILSACLLSSSLFAKNTDDEITKLQKQLAQIQAELAQIRKEREAQVKQNEAVKAELADLNDRADETEFQAALSK
VKFGLEFSTAVSNTNYKVSGQDYSANNKWMNELHLNMNADINDKTKFYGRLSMAKNWSQMGWSGTPYDLDAGRNTRSSGP
VLYVDRAYLDYYITPEWIATVGRQPGTDGPGSNLRNNALRQSTYPALAINALGDAAVITYKPESLQDHKVAIRAAYGKTY
QWDEESGKVRDWMSDQKDADANLYYAAVEGELPIEGMGDNLIIFNVAHMTDFALPIPGSMLLGDDDEVVNLGNLTLANIH
FENYKAFGTNFNWFASLGYSNGSNNEINPLLSTALQSKGYGNGKFNEKDGYAVHVGGRYDFTKALKVGYEFFWGSRYWYT
MSRPSINDPLNIRMTRGTAHDFYVIYQLDRYQFLRLSYTNIQNIWGNRGLPFGGAKKDKARADNIMLMYNVKF