TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0S717|Q0S717_RHOSR ABC amino acid transporter, substrate-binding component OS=Rhodococcus sp. (strain RHA1) GN=RHA1_ro04888 PE=4 SV=1
MRIRSTALTAALAVTALALTGCSGAGADSAGAADGPYRVLVTGGISGQGALAANAQTSVLAAKASAEAVNLAGGVGGRQV
EITVVDDAGDATTAVSKLREAIASGKKPDLFLNSGPSTITTATLPILAQNKILSFNIGPTEDSANPEKYPLNFDLASGPA
ENAETIARYIKGKGYQSVGVVHGSSAYGEVFGQAMDDALSGEGVSSTGSEEYDTAALDMTAQLQSLKNRGTQALVVDAYG
APLGYLLASLQRLDWNIPLVGNTSVAGTSLVSKAAPEGVLGTPATANLVMHVLSSTVYDANDTAVNTMVDNMKAMGDIPS
TLILADNYDALPLVVAAANKAGSSSDPEALADALENQEVLDSAETAFSPSYHFSADSHASKPGDEAYKFVPPSPLLNGQY
GNPSA